- Recombinant Escherichia coli Inner membrane protein yaiY (yaiY)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1063339
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,424 Da
- E Coli or Yeast
- 1-102
- ECK0374, JW0370
- Inner membrane protein yaiY (yaiY)
Sequence
MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLLVHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ